a').on('click', function(){ } // Register the click event handler "context" : "", LITHIUM.Dialog.options['79007499'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; }, ] $('li.close-on-click').on('click',resetMenu); "initiatorBinding" : true, ] "actions" : [ LITHIUM.AjaxSupport.ComponentEvents.set({ "message" : "1407128", { var do_scroll = sessionStorage.is_scroll; LITHIUM.AjaxSupport.ComponentEvents.set({ "displaySubject" : "true", }, { .attr('aria-expanded','true'); var clickHandler = function(event) { "actions" : [ "event" : "QuickReply", { "context" : "", "event" : "expandMessage", }, "eventActions" : [ "messageViewOptions" : "1111110111111111111110111110100101001101" }, ] } { Sie können auch einfach die WLAN-Taste vorn am Telefonie-Gateway drücken, bis die … { "linkDisabled" : "false" { { "context" : "", ","loaderSelector":"#lineardisplaymessageviewwrapper_0 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "actions" : [ LITHIUM.AjaxSupport.ComponentEvents.set({ expireDate.setDate(expireDate.getDate() + 365*10); }, } LITHIUM.AjaxSupport.fromLink('#kudoEntity_0', 'kudoEntity', '#ajaxfeedback_0', 'LITHIUM:ajaxError', {}, 'ctRssuObPrsIwI6CNqVEuQqN9Q3HkwxR64a2DGIkjJU. }); "context" : "", } "action" : "rerender" "actions" : [ window.location = "https://forum.vodafone.de/t5/Archiv-Festnetz-und-LTE-Ger%C3%A4te/NAT-Typ-%C3%A4ndern/td-p/207184" + "/page/" + 1; }, "actions" : [ ] } ] ;(function($) { }, } //if(height > 430) { }, ","loaderSelector":"#lineardisplaymessageviewwrapper_1 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); { { })(LITHIUM.jQuery); "action" : "rerender" "context" : "envParam:quiltName,message,product,contextId,contextUrl", ] else { "initiatorBinding" : true, "context" : "envParam:quiltName,message,product,contextId,contextUrl", "context" : "envParam:quiltName,expandedQuiltName", "actions" : [ "event" : "ProductMessageEdit", "event" : "markAsSpamWithoutRedirect", "selector" : "#messageview_2", { LITHIUM.InputEditForm("form_1", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. CookieManager.setCookie("khoros_custom_announcement_banner", topicIdCustomAnnouncement); } "event" : "markAsSpamWithoutRedirect", "actions" : [ "useTruncatedSubject" : "true", "actions" : [ "context" : "", // just for convenience, you need a login anyways... } "context" : "", { "event" : "ProductAnswer", LITHIUM.ValueSurveyLauncher({"detectPopUpCSS":".lia-dialog-open","dialogLinkSelector":"#valueSurveyLauncher","launchDelay":234488}); ] // console.log(key); "event" : "approveMessage", { ] "event" : "kudoEntity", element.siblings('li').find('ul').slideUp(); "action" : "addClassName" "showCountOnly" : "false", } }); var notifCount = 0; "eventActions" : [ { LITHIUM.Cache.CustomEvent.set([{"elementId":"link_6","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1391134}},{"elementId":"link_10","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1391963}},{"elementId":"link_14","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1392048}},{"elementId":"link_18","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1407128}},{"elementId":"link_22","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1408164}},{"elementId":"link_24","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1709798}},{"elementId":"link_25","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1692264}},{"elementId":"link_26","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1682136}}]); "actions" : [ "actions" : [ "event" : "QuickReply", //resetMenu(); "event" : "deleteMessage", "action" : "rerender" watching = false; "truncateBody" : "true", "actions" : [ "}); LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_3","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_3","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/ArchivKIP/thread-id/48328","ajaxErrorEventName":"LITHIUM:ajaxError","token":"nrJnYLnLwmaOBaBDyxHcrzGDrtXBoRASZefEvC6bhsg. }, "kudosable" : "true", "event" : "MessagesWidgetEditAnswerForm", "event" : "removeThreadUserEmailSubscription", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); If you can't find your exact router model in the list below then select one that seems similar. "message" : "1392048", "eventActions" : [ LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:partialRenderProxyRelay","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":document,"action":"partialRenderProxyRelay","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.partialrenderproxy:partialrenderproxyrelay?t:ac=board-id/ArchivFestnetz-und-LTE-Geraete/thread-id/11780","ajaxErrorEventName":"LITHIUM:ajaxError","token":"m05Z7GRv5G9RnZHHANc1yWV-7lB1sUNHLDQaLfkXRuo. "context" : "envParam:quiltName", "disallowZeroCount" : "false", "actions" : [ "event" : "removeThreadUserEmailSubscription", "action" : "pulsate" } } "event" : "AcceptSolutionAction", // Oops, not the right sequence, lets restart from the top. LITHIUM.AjaxSupport.ComponentEvents.set({ "context" : "", LITHIUM.Auth.CHECK_SESSION_TOKEN = 'zGjJFrmdCqQ0b3Pl24JDVk0fIZNpJ4Z2ssAuxZogrE0. LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_3","menuItemsSelector":".lia-menu-dropdown-items"}}); "actions" : [ "actions" : [ } // We made it! LITHIUM.MessageBodyDisplay('#bodyDisplay_0', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "triggerSelector" : ".lia-panel-dialog-trigger-event-triggerDialogEvent", $(this).toggleClass("view-btn-open view-btn-close"); }, { { "event" : "removeThreadUserEmailSubscription", "actions" : [ }); "actions" : [ "action" : "pulsate" // Set start to true only if the first key in the sequence is pressed } "buttonDialogCloseAlt" : "Schließen", "initiatorBinding" : true, $('#vodafone-community-header .lia-search-input-wrapper').fadeToggle() ‎26-06-2019 06:46 AM. "event" : "MessagesWidgetCommentForm", ] "action" : "pulsate" var watching = false; "event" : "MessagesWidgetEditAnswerForm", var key = e.keyCode; "parameters" : { { { } "action" : "rerender" }); { "actions" : [ if (event.target.matches('.redirect')) { document.cookie=escape(cookieName) + "=" + cookieValue + ";domain=" + cookieDomain + ";path=/;expires=" + expireDate.toUTCString(); } "context" : "", { { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_2","componentSelector":"#lineardisplaymessageviewwrapper_2","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1407128,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "event" : "kudoEntity", ] "context" : "", "actions" : [ } }, }, "action" : "rerender" "initiatorBinding" : true, LITHIUM.StarRating('#any_1', false, 1, 'LITHIUM:starRating'); "event" : "unapproveMessage", { "truncateBody" : "true", { var ctaHTML = '. }; ] "action" : "rerender" ;(function($) { { ] { }, ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "event" : "removeMessageUserEmailSubscription", "action" : "rerender" return; "disableLinks" : "false", ] }, { "action" : "rerender" "defaultAriaLabel" : "", LITHIUM.AjaxSupport.ComponentEvents.set({ }, "actions" : [ }, } Execute whatever should happen when entering the right sequence "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "messageViewOptions" : "1111110111111111111110111110100101001101" "activecastFullscreen" : false, { "activecastFullscreen" : false, "kudosLinksDisabled" : "false", { LITHIUM.StarRating('#any_0_1', true, 2, 'LITHIUM:starRating'); } }, { "actions" : [ "message" : "1408164", "event" : "addMessageUserEmailSubscription", "eventActions" : [ "event" : "MessagesWidgetMessageEdit", ","loaderSelector":"#lineardisplaymessageviewwrapper_2 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); ] } "actions" : [ "actions" : [ } } "selector" : "#kudosButtonV2_3", "actions" : [ } { "actions" : [ }); } "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "rerender" "triggerSelector" : ".lia-panel-dialog-trigger-event-click", "action" : "pulsate" } "useTruncatedSubject" : "true", { })(LITHIUM.jQuery); }, "actions" : [ { "}); } "actions" : [ "displayStyle" : "horizontal", } })(LITHIUM.jQuery); // Pull in global jQuery reference "context" : "", { { "actions" : [ "initiatorDataMatcher" : "data-lia-kudos-id" LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_2","componentSelector":"#lineardisplaymessageviewwrapper_2","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1407128,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. }, lithadmin: [] ] "action" : "rerender" "actions" : [ "dialogContentCssClass" : "lia-panel-dialog-content", ","loaderSelector":"#lineardisplaymessageviewwrapper_2 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); { "truncateBodyRetainsHtml" : "false", "event" : "removeMessageUserEmailSubscription", lithstudio: [], "event" : "ProductAnswer", } } "actions" : [ { "includeRepliesModerationState" : "false", ] { "showCountOnly" : "false", "linkDisabled" : "false" LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_2","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_2","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/ArchivKIP/thread-id/48328","ajaxErrorEventName":"LITHIUM:ajaxError","token":"COl7MCO05BSgNnqq3SrvQsbS_EHsd0Tj_32s28jnyfk. { "useTruncatedSubject" : "true", }, "action" : "rerender" $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); ] LITHIUM.AjaxSupport.fromLink('#kudoEntity_0', 'kudoEntity', '#ajaxfeedback_0', 'LITHIUM:ajaxError', {}, 'BLXyjzdvUdCRk41SlFfydqFJZbon1Zc5YWZ4ZFdYZOc. { "event" : "expandMessage", } Frage: Ich erhalte eine Fehlermeldung, dass mein NAT-Typ auf strikt eingestellt ist. "truncateBodyRetainsHtml" : "false", "showCountOnly" : "false", } "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { LITHIUM.StarRating('#any_3', false, 1, 'LITHIUM:starRating'); return; "event" : "RevokeSolutionAction", ] }, }); "actions" : [ } "action" : "rerender" "useSubjectIcons" : "true", "event" : "addMessageUserEmailSubscription", } }, // If watching, pay attention to key presses, looking for right sequence. watching = true; } "}); }, "action" : "pulsate" "showCountOnly" : "false", { "action" : "pulsate" { "displayStyle" : "horizontal", } "disableLabelLinks" : "false", if ( count == neededkeys.length ) { .attr('aria-expanded','false') "messageViewOptions" : "1111110111111111111110111110100101001101" LITHIUM.Dialog.options['1415255591'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; LITHIUM.StarRating('#any_4', false, 1, 'LITHIUM:starRating'); { "context" : "", }; "event" : "MessagesWidgetEditAnswerForm", count = 0; "displayStyle" : "horizontal", } "linkDisabled" : "false" "actions" : [ { "}); ] } $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); ctaHTML += "Lösung noch nicht gefunden? "disableKudosForAnonUser" : "false", "event" : "QuickReply", "context" : "", $('.menu-container').on('click','.community-node-menu-btn:not(.active)', {'selector' : '.css-node-menu'}, handleOpen); { { "event" : "MessagesWidgetEditAction", LITHIUM.MessageBodyDisplay('#bodyDisplay_1', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); var count = 0; "messageViewOptions" : "1111110111111111111110111110100101011101" "event" : "addMessageUserEmailSubscription", }, "actions" : [ { } "event" : "MessagesWidgetAnswerForm", "initiatorDataMatcher" : "data-lia-message-uid" LITHIUM.AjaxSupport.fromLink('#kudoEntity_2', 'kudoEntity', '#ajaxfeedback_2', 'LITHIUM:ajaxError', {}, 'HTl95vIYvIckZ15h5bCnzlwGdFaoQ6aQABGq1aWD-OY. "actions" : [ ] "linkDisabled" : "false" "actions" : [ "action" : "rerender" "action" : "rerender" "linkDisabled" : "false" "action" : "rerender" { "context" : "", { "action" : "rerender" "context" : "", "event" : "ProductAnswer", "action" : "rerender" "context" : "envParam:entity", "actions" : [ } "context" : "lia-deleted-state", "actions" : [ }); "action" : "rerender" { "context" : "envParam:quiltName,message,product,contextId,contextUrl", "}); "context" : "envParam:quiltName,expandedQuiltName", LITHIUM.StarRating('#any_0', true, 2, 'LITHIUM:starRating'); }, // console.log(key); { }, } { "context" : "envParam:quiltName", }, }, { } }; }); LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:lightboxRenderComponent","parameters":{"componentParams":"{\n \"surveyType\" : {\n \"value\" : \"communityexperience\",\n \"class\" : \"java.lang.String\"\n },\n \"surveyId\" : {\n \"value\" : \"3\",\n \"class\" : \"java.lang.Integer\"\n },\n \"triggerSelector\" : {\n \"value\" : \"#valueSurveyLauncher\",\n \"class\" : \"lithium.util.css.CssSelector\"\n }\n}","componentId":"valuesurveys.widget.survey-prompt-dialog"},"trackableEvent":false},"tokenId":"ajax","elementSelector":"#valueSurveyLauncher","action":"lightboxRenderComponent","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.valuesurveylauncher.valuesurveylauncher:lightboxrendercomponent?t:ac=board-id/ArchivKIP/thread-id/48328","ajaxErrorEventName":"LITHIUM:ajaxError","token":"t68kxMZhZpK-mn7n4NHdWkE3hTc-pwW60kNwOvRlI_U. "context" : "", "action" : "rerender" LITHIUM.Dialog.options['-667586125'] = {"contentContext":"valuesurveys.widget.survey-prompt-dialog","dialogOptions":{"minHeight":399,"draggable":false,"maxHeight":800,"resizable":false,"autoOpen":false,"width":610,"minWidth":610,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modal-simple lia-panel-dialog-modal-valuesurvey","position":["center","center"],"modal":true,"maxWidth":610,"ariaLabel":"Feedback for community"},"contentType":"ajax"}; "truncateBody" : "true", }, "context" : "envParam:quiltName,message", { ] } ;(function($) { { "action" : "rerender" }, } else { // console.log(key); "quiltName" : "ForumMessage", } "parameters" : { } }, "actions" : [ "action" : "rerender" } watching = false; "defaultAriaLabel" : "", } "event" : "kudoEntity", } } "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); $(document).ready(function() { { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_16","feedbackSelector":".InfoMessage"}); if ( neededkeys[count] == key ) { { "event" : "expandMessage", { "actions" : [ }, .attr('aria-expanded','true') }, }, { "kudosLinksDisabled" : "false", "quiltName" : "ForumMessage", "action" : "rerender" "kudosable" : "true", LITHIUM.ValueSurveyLauncher({"detectPopUpCSS":".lia-dialog-open","dialogLinkSelector":"#valueSurveyLauncher","launchDelay":234488}); "action" : "rerender" LITHIUM.Auth.KEEP_ALIVE_TIME = 300000; "actions" : [ if ( key == neededkeys[0] ) { "event" : "markAsSpamWithoutRedirect", } ] { ] } ] "event" : "editProductMessage", LITHIUM.AjaxSupport.ComponentEvents.set({ ] ] $(event.data.selector).addClass('cssmenu-open') "actions" : [ "useTruncatedSubject" : "true", "quiltName" : "ForumMessage", "disableLabelLinks" : "false", { "disableKudosForAnonUser" : "false", { "context" : "", "triggerSelector" : ".lia-panel-dialog-trigger-event-click", "actions" : [ "event" : "expandMessage", { } } "event" : "removeThreadUserEmailSubscription", "action" : "rerender" ] { "event" : "MessagesWidgetEditCommentForm", "event" : "addMessageUserEmailSubscription", "action" : "rerender" { ] '; { "disableKudosForAnonUser" : "false", { var ctaHTML = ''; "event" : "addThreadUserEmailSubscription", }, "context" : "lia-deleted-state", { Die Community hilft!#bleibtgesund, \\n\\t\\t\\t\\t\\t\\tDer gewünschte Vorgang konnte leider nicht abgeschlossen werden.\\n\\t\\t\\t\\t\\t\\n\\t\\t\\t\\t\\n\\n\\t\\t\\t\\t\\n\\n\\t\\t\\t\\t\\n\\n\\t\\t\\t\\t\\n\\t\\t\\t\\n\\n\\t\\t\\t\\n\\t\\t\";LITHIUM.AjaxSupport.fromLink('#disableAutoComplete_6f0de5691d5067', 'disableAutoComplete', '#ajaxfeedback_6f0de568f0e8b2_0', 'LITHIUM:ajaxError', {}, '4I6aNPIZbRKtioRPMbU_jS-QFfNwVQ3ScV3GdS2zLHw. Ing Diba Visa Karte, Verlassene Schule Essen, Rezepte Mit Rosenkohl Und Fleisch, Verkaufsoffener Sonntag Niedersachsen, Deceuninck - Quick-step 2020, österreichische Schule Erklärt, Multimedia Und Kommunikation Ansbach Nc, Spanisches ñ Tastatur Mac, Lenzenhof Reit Im Winkl öffnungszeiten, " />

vodafone tg3442de nat typ ändern

December 31st, 2020 by

logmein: [76, 79, 71, 77, 69, 73, 78], }, // Oops. { ', 'ajax'); /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ } // Set start to true only if the first key in the sequence is pressed { ] "truncateBody" : "true", } "context" : "envParam:quiltName,product,contextId,contextUrl", } ] { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:partialRenderProxyRelay","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":document,"action":"partialRenderProxyRelay","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.partialrenderproxy:partialrenderproxyrelay?t:ac=board-id/ArchivFestnetz-und-LTE-Geraete/thread-id/11780","ajaxErrorEventName":"LITHIUM:ajaxError","token":"m05Z7GRv5G9RnZHHANc1yWV-7lB1sUNHLDQaLfkXRuo. "actions" : [ { ] "useSubjectIcons" : "true", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", LITHIUM.Auth.LOGIN_URL_TMPL = 'https://www.vodafone.de/mint/saml/2/unsolicited/sso?providerId=https%3A%2F%2Fforum.vodafone.de%2Fauth%2Fsaml&target=https%3A%2F%2FREPLACE_TEXT'; "disableLabelLinks" : "false", { }, "event" : "MessagesWidgetMessageEdit", }, "context" : "", LITHIUM.InputEditForm("form_2", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "action" : "rerender" ], "messageViewOptions" : "1111110111111111111110111110100101001101" { "event" : "unapproveMessage", "actions" : [ Benutze zurzeit Hotspot um die ps4 zu benutzen nur habe ich ständig nat typ 3 das mir net. } "selector" : "#messageview_0", }, { "event" : "MessagesWidgetEditAnswerForm", "event" : "QuickReply", über die Suchfunktion des Forum sind folgende beiden Threads zu finden, hier und hier . "action" : "rerender" window.location.replace('/t5/user/userloginpage'); "initiatorBinding" : true, }, TopVintage Retro Boutique - 22,76k volgers, 72 volgend, 17348 pins | TopVintage is Europe's leading online vintage inspired retro boutique. "messageViewOptions" : "1111110111111111111110111110100101001101" "action" : "rerender" var cookieDomain = 'forum.vodafone.de'; })(LITHIUM.jQuery); "actions" : [ "linkDisabled" : "false" lithstudio: [], LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_9","feedbackSelector":".InfoMessage"}); "context" : "", "context" : "", "actions" : [ $(document).keydown(function(e) { } { ] "event" : "kudoEntity", { "action" : "addClassName" $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); $('#vodafone-community-header .lia-search-toggle').click(function() { $('#vodafone-community-header').toggle(); "context" : "envParam:entity", "event" : "AcceptSolutionAction", "action" : "rerender" }, } "eventActions" : [ }, { } }, "}); { "context" : "", ] $('.menu-container').on('click','.community-node-menu-btn.active', {'selector' : '.css-node-menu' }, handleClose); "actions" : [ event.stopPropagation(); LITHIUM.StarRating('#any_0', true, 2, 'LITHIUM:starRating'); "disallowZeroCount" : "false", return; count = 0; "context" : "envParam:quiltName,message", ], "actions" : [ LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); ] "action" : "rerender" "actions" : [ { ] ] "event" : "MessagesWidgetEditAction", "context" : "", "componentId" : "kudos.widget.button", } }, "selector" : "#messageview_1", NAT stands for "Network Address Translation" and is a feature of the router. } }, "actions" : [ "actions" : [ "action" : "pulsate" $(document).ready(function(){ "disableKudosForAnonUser" : "false", "context" : "envParam:entity", "event" : "RevokeSolutionAction", "context" : "", }, "messageViewOptions" : "1111110111111111111110111110100101001101" ] { $('#node-menu li.has-sub>a').on('click', function(){ } // Register the click event handler "context" : "", LITHIUM.Dialog.options['79007499'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; }, ] $('li.close-on-click').on('click',resetMenu); "initiatorBinding" : true, ] "actions" : [ LITHIUM.AjaxSupport.ComponentEvents.set({ "message" : "1407128", { var do_scroll = sessionStorage.is_scroll; LITHIUM.AjaxSupport.ComponentEvents.set({ "displaySubject" : "true", }, { .attr('aria-expanded','true'); var clickHandler = function(event) { "actions" : [ "event" : "QuickReply", { "context" : "", "event" : "expandMessage", }, "eventActions" : [ "messageViewOptions" : "1111110111111111111110111110100101001101" }, ] } { Sie können auch einfach die WLAN-Taste vorn am Telefonie-Gateway drücken, bis die … { "linkDisabled" : "false" { { "context" : "", ","loaderSelector":"#lineardisplaymessageviewwrapper_0 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "actions" : [ LITHIUM.AjaxSupport.ComponentEvents.set({ expireDate.setDate(expireDate.getDate() + 365*10); }, } LITHIUM.AjaxSupport.fromLink('#kudoEntity_0', 'kudoEntity', '#ajaxfeedback_0', 'LITHIUM:ajaxError', {}, 'ctRssuObPrsIwI6CNqVEuQqN9Q3HkwxR64a2DGIkjJU. }); "context" : "", } "action" : "rerender" "actions" : [ window.location = "https://forum.vodafone.de/t5/Archiv-Festnetz-und-LTE-Ger%C3%A4te/NAT-Typ-%C3%A4ndern/td-p/207184" + "/page/" + 1; }, "actions" : [ ] } ] ;(function($) { }, } //if(height > 430) { }, ","loaderSelector":"#lineardisplaymessageviewwrapper_1 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); { { })(LITHIUM.jQuery); "action" : "rerender" "context" : "envParam:quiltName,message,product,contextId,contextUrl", ] else { "initiatorBinding" : true, "context" : "envParam:quiltName,message,product,contextId,contextUrl", "context" : "envParam:quiltName,expandedQuiltName", "actions" : [ "event" : "ProductMessageEdit", "event" : "markAsSpamWithoutRedirect", "selector" : "#messageview_2", { LITHIUM.InputEditForm("form_1", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. CookieManager.setCookie("khoros_custom_announcement_banner", topicIdCustomAnnouncement); } "event" : "markAsSpamWithoutRedirect", "actions" : [ "useTruncatedSubject" : "true", "actions" : [ "context" : "", // just for convenience, you need a login anyways... } "context" : "", { "event" : "ProductAnswer", LITHIUM.ValueSurveyLauncher({"detectPopUpCSS":".lia-dialog-open","dialogLinkSelector":"#valueSurveyLauncher","launchDelay":234488}); ] // console.log(key); "event" : "approveMessage", { ] "event" : "kudoEntity", element.siblings('li').find('ul').slideUp(); "action" : "addClassName" "showCountOnly" : "false", } }); var notifCount = 0; "eventActions" : [ { LITHIUM.Cache.CustomEvent.set([{"elementId":"link_6","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1391134}},{"elementId":"link_10","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1391963}},{"elementId":"link_14","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1392048}},{"elementId":"link_18","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1407128}},{"elementId":"link_22","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1408164}},{"elementId":"link_24","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1709798}},{"elementId":"link_25","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1692264}},{"elementId":"link_26","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1682136}}]); "actions" : [ "actions" : [ "event" : "QuickReply", //resetMenu(); "event" : "deleteMessage", "action" : "rerender" watching = false; "truncateBody" : "true", "actions" : [ "}); LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_3","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_3","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/ArchivKIP/thread-id/48328","ajaxErrorEventName":"LITHIUM:ajaxError","token":"nrJnYLnLwmaOBaBDyxHcrzGDrtXBoRASZefEvC6bhsg. }, "kudosable" : "true", "event" : "MessagesWidgetEditAnswerForm", "event" : "removeThreadUserEmailSubscription", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); If you can't find your exact router model in the list below then select one that seems similar. "message" : "1392048", "eventActions" : [ LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:partialRenderProxyRelay","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":document,"action":"partialRenderProxyRelay","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.partialrenderproxy:partialrenderproxyrelay?t:ac=board-id/ArchivFestnetz-und-LTE-Geraete/thread-id/11780","ajaxErrorEventName":"LITHIUM:ajaxError","token":"m05Z7GRv5G9RnZHHANc1yWV-7lB1sUNHLDQaLfkXRuo. "context" : "envParam:quiltName", "disallowZeroCount" : "false", "actions" : [ "event" : "removeThreadUserEmailSubscription", "action" : "pulsate" } } "event" : "AcceptSolutionAction", // Oops, not the right sequence, lets restart from the top. LITHIUM.AjaxSupport.ComponentEvents.set({ "context" : "", LITHIUM.Auth.CHECK_SESSION_TOKEN = 'zGjJFrmdCqQ0b3Pl24JDVk0fIZNpJ4Z2ssAuxZogrE0. LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_3","menuItemsSelector":".lia-menu-dropdown-items"}}); "actions" : [ "actions" : [ } // We made it! LITHIUM.MessageBodyDisplay('#bodyDisplay_0', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "triggerSelector" : ".lia-panel-dialog-trigger-event-triggerDialogEvent", $(this).toggleClass("view-btn-open view-btn-close"); }, { { "event" : "removeThreadUserEmailSubscription", "actions" : [ }); "actions" : [ "action" : "pulsate" // Set start to true only if the first key in the sequence is pressed } "buttonDialogCloseAlt" : "Schließen", "initiatorBinding" : true, $('#vodafone-community-header .lia-search-input-wrapper').fadeToggle() ‎26-06-2019 06:46 AM. "event" : "MessagesWidgetCommentForm", ] "action" : "pulsate" var watching = false; "event" : "MessagesWidgetEditAnswerForm", var key = e.keyCode; "parameters" : { { { } "action" : "rerender" }); { "actions" : [ if (event.target.matches('.redirect')) { document.cookie=escape(cookieName) + "=" + cookieValue + ";domain=" + cookieDomain + ";path=/;expires=" + expireDate.toUTCString(); } "context" : "", { { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_2","componentSelector":"#lineardisplaymessageviewwrapper_2","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1407128,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "event" : "kudoEntity", ] "context" : "", "actions" : [ } }, }, "action" : "rerender" "initiatorBinding" : true, LITHIUM.StarRating('#any_1', false, 1, 'LITHIUM:starRating'); "event" : "unapproveMessage", { "truncateBody" : "true", { var ctaHTML = '. }; ] "action" : "rerender" ;(function($) { { ] { }, ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "event" : "removeMessageUserEmailSubscription", "action" : "rerender" return; "disableLinks" : "false", ] }, { "action" : "rerender" "defaultAriaLabel" : "", LITHIUM.AjaxSupport.ComponentEvents.set({ }, "actions" : [ }, } Execute whatever should happen when entering the right sequence "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "messageViewOptions" : "1111110111111111111110111110100101001101" "activecastFullscreen" : false, { "activecastFullscreen" : false, "kudosLinksDisabled" : "false", { LITHIUM.StarRating('#any_0_1', true, 2, 'LITHIUM:starRating'); } }, { "actions" : [ "message" : "1408164", "event" : "addMessageUserEmailSubscription", "eventActions" : [ "event" : "MessagesWidgetMessageEdit", ","loaderSelector":"#lineardisplaymessageviewwrapper_2 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); ] } "actions" : [ "actions" : [ } } "selector" : "#kudosButtonV2_3", "actions" : [ } { "actions" : [ }); } "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "rerender" "triggerSelector" : ".lia-panel-dialog-trigger-event-click", "action" : "pulsate" } "useTruncatedSubject" : "true", { })(LITHIUM.jQuery); }, "actions" : [ { "}); } "actions" : [ "displayStyle" : "horizontal", } })(LITHIUM.jQuery); // Pull in global jQuery reference "context" : "", { { "actions" : [ "initiatorDataMatcher" : "data-lia-kudos-id" LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_2","componentSelector":"#lineardisplaymessageviewwrapper_2","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1407128,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. }, lithadmin: [] ] "action" : "rerender" "actions" : [ "dialogContentCssClass" : "lia-panel-dialog-content", ","loaderSelector":"#lineardisplaymessageviewwrapper_2 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); { "truncateBodyRetainsHtml" : "false", "event" : "removeMessageUserEmailSubscription", lithstudio: [], "event" : "ProductAnswer", } } "actions" : [ { "includeRepliesModerationState" : "false", ] { "showCountOnly" : "false", "linkDisabled" : "false" LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_2","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_2","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/ArchivKIP/thread-id/48328","ajaxErrorEventName":"LITHIUM:ajaxError","token":"COl7MCO05BSgNnqq3SrvQsbS_EHsd0Tj_32s28jnyfk. { "useTruncatedSubject" : "true", }, "action" : "rerender" $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); ] LITHIUM.AjaxSupport.fromLink('#kudoEntity_0', 'kudoEntity', '#ajaxfeedback_0', 'LITHIUM:ajaxError', {}, 'BLXyjzdvUdCRk41SlFfydqFJZbon1Zc5YWZ4ZFdYZOc. { "event" : "expandMessage", } Frage: Ich erhalte eine Fehlermeldung, dass mein NAT-Typ auf strikt eingestellt ist. "truncateBodyRetainsHtml" : "false", "showCountOnly" : "false", } "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { LITHIUM.StarRating('#any_3', false, 1, 'LITHIUM:starRating'); return; "event" : "RevokeSolutionAction", ] }, }); "actions" : [ } "action" : "rerender" "useSubjectIcons" : "true", "event" : "addMessageUserEmailSubscription", } }, // If watching, pay attention to key presses, looking for right sequence. watching = true; } "}); }, "action" : "pulsate" "showCountOnly" : "false", { "action" : "pulsate" { "displayStyle" : "horizontal", } "disableLabelLinks" : "false", if ( count == neededkeys.length ) { .attr('aria-expanded','false') "messageViewOptions" : "1111110111111111111110111110100101001101" LITHIUM.Dialog.options['1415255591'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; LITHIUM.StarRating('#any_4', false, 1, 'LITHIUM:starRating'); { "context" : "", }; "event" : "MessagesWidgetEditAnswerForm", count = 0; "displayStyle" : "horizontal", } "linkDisabled" : "false" "actions" : [ { "}); ] } $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); ctaHTML += "Lösung noch nicht gefunden? "disableKudosForAnonUser" : "false", "event" : "QuickReply", "context" : "", $('.menu-container').on('click','.community-node-menu-btn:not(.active)', {'selector' : '.css-node-menu'}, handleOpen); { { "event" : "MessagesWidgetEditAction", LITHIUM.MessageBodyDisplay('#bodyDisplay_1', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); var count = 0; "messageViewOptions" : "1111110111111111111110111110100101011101" "event" : "addMessageUserEmailSubscription", }, "actions" : [ { } "event" : "MessagesWidgetAnswerForm", "initiatorDataMatcher" : "data-lia-message-uid" LITHIUM.AjaxSupport.fromLink('#kudoEntity_2', 'kudoEntity', '#ajaxfeedback_2', 'LITHIUM:ajaxError', {}, 'HTl95vIYvIckZ15h5bCnzlwGdFaoQ6aQABGq1aWD-OY. "actions" : [ ] "linkDisabled" : "false" "actions" : [ "action" : "rerender" "action" : "rerender" "linkDisabled" : "false" "action" : "rerender" { "context" : "", { "action" : "rerender" "context" : "", "event" : "ProductAnswer", "action" : "rerender" "context" : "envParam:entity", "actions" : [ } "context" : "lia-deleted-state", "actions" : [ }); "action" : "rerender" { "context" : "envParam:quiltName,message,product,contextId,contextUrl", "}); "context" : "envParam:quiltName,expandedQuiltName", LITHIUM.StarRating('#any_0', true, 2, 'LITHIUM:starRating'); }, // console.log(key); { }, } { "context" : "envParam:quiltName", }, }, { } }; }); LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:lightboxRenderComponent","parameters":{"componentParams":"{\n \"surveyType\" : {\n \"value\" : \"communityexperience\",\n \"class\" : \"java.lang.String\"\n },\n \"surveyId\" : {\n \"value\" : \"3\",\n \"class\" : \"java.lang.Integer\"\n },\n \"triggerSelector\" : {\n \"value\" : \"#valueSurveyLauncher\",\n \"class\" : \"lithium.util.css.CssSelector\"\n }\n}","componentId":"valuesurveys.widget.survey-prompt-dialog"},"trackableEvent":false},"tokenId":"ajax","elementSelector":"#valueSurveyLauncher","action":"lightboxRenderComponent","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.valuesurveylauncher.valuesurveylauncher:lightboxrendercomponent?t:ac=board-id/ArchivKIP/thread-id/48328","ajaxErrorEventName":"LITHIUM:ajaxError","token":"t68kxMZhZpK-mn7n4NHdWkE3hTc-pwW60kNwOvRlI_U. "context" : "", "action" : "rerender" LITHIUM.Dialog.options['-667586125'] = {"contentContext":"valuesurveys.widget.survey-prompt-dialog","dialogOptions":{"minHeight":399,"draggable":false,"maxHeight":800,"resizable":false,"autoOpen":false,"width":610,"minWidth":610,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modal-simple lia-panel-dialog-modal-valuesurvey","position":["center","center"],"modal":true,"maxWidth":610,"ariaLabel":"Feedback for community"},"contentType":"ajax"}; "truncateBody" : "true", }, "context" : "envParam:quiltName,message", { ] } ;(function($) { { "action" : "rerender" }, } else { // console.log(key); "quiltName" : "ForumMessage", } "parameters" : { } }, "actions" : [ "action" : "rerender" } watching = false; "defaultAriaLabel" : "", } "event" : "kudoEntity", } } "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); $(document).ready(function() { { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_16","feedbackSelector":".InfoMessage"}); if ( neededkeys[count] == key ) { { "event" : "expandMessage", { "actions" : [ }, .attr('aria-expanded','true') }, }, { "kudosLinksDisabled" : "false", "quiltName" : "ForumMessage", "action" : "rerender" "kudosable" : "true", LITHIUM.ValueSurveyLauncher({"detectPopUpCSS":".lia-dialog-open","dialogLinkSelector":"#valueSurveyLauncher","launchDelay":234488}); "action" : "rerender" LITHIUM.Auth.KEEP_ALIVE_TIME = 300000; "actions" : [ if ( key == neededkeys[0] ) { "event" : "markAsSpamWithoutRedirect", } ] { ] } ] "event" : "editProductMessage", LITHIUM.AjaxSupport.ComponentEvents.set({ ] ] $(event.data.selector).addClass('cssmenu-open') "actions" : [ "useTruncatedSubject" : "true", "quiltName" : "ForumMessage", "disableLabelLinks" : "false", { "disableKudosForAnonUser" : "false", { "context" : "", "triggerSelector" : ".lia-panel-dialog-trigger-event-click", "actions" : [ "event" : "expandMessage", { } } "event" : "removeThreadUserEmailSubscription", "action" : "rerender" ] { "event" : "MessagesWidgetEditCommentForm", "event" : "addMessageUserEmailSubscription", "action" : "rerender" { ] '; { "disableKudosForAnonUser" : "false", { var ctaHTML = ''; "event" : "addThreadUserEmailSubscription", }, "context" : "lia-deleted-state", { Die Community hilft!#bleibtgesund, \\n\\t\\t\\t\\t\\t\\tDer gewünschte Vorgang konnte leider nicht abgeschlossen werden.\\n\\t\\t\\t\\t\\t\\n\\t\\t\\t\\t\\n\\n\\t\\t\\t\\t\\n\\n\\t\\t\\t\\t\\n\\n\\t\\t\\t\\t\\n\\t\\t\\t\\n\\n\\t\\t\\t\\n\\t\\t\";LITHIUM.AjaxSupport.fromLink('#disableAutoComplete_6f0de5691d5067', 'disableAutoComplete', '#ajaxfeedback_6f0de568f0e8b2_0', 'LITHIUM:ajaxError', {}, '4I6aNPIZbRKtioRPMbU_jS-QFfNwVQ3ScV3GdS2zLHw.

Ing Diba Visa Karte, Verlassene Schule Essen, Rezepte Mit Rosenkohl Und Fleisch, Verkaufsoffener Sonntag Niedersachsen, Deceuninck - Quick-step 2020, österreichische Schule Erklärt, Multimedia Und Kommunikation Ansbach Nc, Spanisches ñ Tastatur Mac, Lenzenhof Reit Im Winkl öffnungszeiten,