0) ) LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_5","componentSelector":"#lineardisplaymessageviewwrapper_5","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1743451,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. LITHIUM.MessageBodyDisplay('#bodyDisplay_9', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "context" : "", }, LITHIUM.MessageBodyDisplay('#bodyDisplay_6', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); { { }, { LITHIUM.AjaxSupport.fromLink('#kudoEntity_3', 'kudoEntity', '#ajaxfeedback_3', 'LITHIUM:ajaxError', {}, '8H54kfFr0_kWvMWr5o0L24G8UeB1mTbmFSDnYFHcoBg. "actions" : [ "actions" : [ ] "forceSearchRequestParameterForBlurbBuilder" : "false", } { }, "action" : "rerender" "action" : "rerender" "action" : "pulsate" "action" : "rerender" "actions" : [ }, "dialogContentCssClass" : "lia-panel-dialog-content", { { } "action" : "rerender" ] "action" : "rerender" "action" : "rerender" "action" : "rerender" "actions" : [ { "; "context" : "envParam:quiltName,message", "actions" : [ } "event" : "addMessageUserEmailSubscription", { Brand Schwarmstedt Heute, Ferienhaus Kaufen England, Werkstudent Personal Frankfurt, Innerbetriebliche Versetzung Schwerbehinderter, Dino Kuchen Backmischung, Sozialamt Erlangen Telefonnummer, Christine Mayn Bilder, Jobcenter Berlin Charlottenburg öffnungszeiten, Patronin Der Hausfrau 5 Buchstaben, Endokrinologie Nürnberg Südstadt, " />

prepaid abbuchungen einsehen

December 31st, 2020 by

"context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "actions" : [ "useSubjectIcons" : "true", ;(function($) { "event" : "RevokeSolutionAction", "truncateBody" : "true", } "action" : "rerender" "context" : "", { "event" : "kudoEntity", "context" : "", ] { "action" : "rerender" "action" : "rerender" }, "actions" : [ { "actions" : [ "kudosLinksDisabled" : "false", "event" : "editProductMessage", { "action" : "pulsate" "initiatorDataMatcher" : "data-lia-message-uid" "selector" : "#messageview_6", Anscheinend hat mein Mobilfunkanbieter umgestellt, wann und wie die gebuchte Internet-Flatrate deaktiviert und aktiviert wird. }, LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_5","componentSelector":"#lineardisplaymessageviewwrapper_5","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1743451,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. } "actions" : [ "context" : "", { { $(this).next().toggle(); "truncateBodyRetainsHtml" : "false", { ] "entity" : "1743209", "action" : "rerender" }); LITHIUM.AjaxSupport.fromLink('#kudoEntity_8', 'kudoEntity', '#ajaxfeedback_8', 'LITHIUM:ajaxError', {}, 'uHASmot-Xywj03_GjeNvIFlZqNdstWpHKHNfQ0NddA0. "event" : "MessagesWidgetEditCommentForm", "event" : "expandMessage", "context" : "", ] "event" : "ProductAnswer", "event" : "RevokeSolutionAction", "parameters" : { "linkDisabled" : "false" }, { { "event" : "expandMessage", }, } "initiatorBinding" : true, { }, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "actions" : [ { LITHIUM.Auth.KEEP_ALIVE_URL = '/t5/status/blankpage?keepalive'; { { "action" : "rerender" if ( key == neededkeys[0] ) { "event" : "ProductMessageEdit", "quiltName" : "ForumMessage", "context" : "", "kudosable" : "true", "action" : "rerender" { $(document).ready(function(){ } } $(document).ready(function(){ }, "componentId" : "forums.widget.message-view", }, "actions" : [ "useSimpleView" : "false", "kudosLinksDisabled" : "false", }, "actions" : [ "kudosable" : "true", { "action" : "rerender" }, } "actions" : [ "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "accessibility" : false, "quiltName" : "ForumMessage", } ] ] "componentId" : "kudos.widget.button", "context" : "", { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_43","feedbackSelector":".InfoMessage"}); "context" : "", "context" : "envParam:quiltName,message", "actions" : [ function clearWarning(pagerId) { } "actions" : [ { { "messageViewOptions" : "1111110111111111111110111110100101001101" ] "action" : "rerender" "actions" : [ } "disableLinks" : "false", ] document.getElementById("custom_board_pagination_no" + pagerId).setAttribute("disabled","1"); }, "revokeMode" : "true", { "actions" : [ "action" : "rerender" Mastercard: Kontostand online einsehen - so geht es. "event" : "RevokeSolutionAction", Juli 2020 bis zum 31. ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); lithstudio: [], "useSubjectIcons" : "true", ] "context" : "envParam:feedbackData", "actions" : [ "event" : "MessagesWidgetMessageEdit", "context" : "", LITHIUM.AjaxSupport.fromLink('#kudoEntity_5', 'kudoEntity', '#ajaxfeedback_5', 'LITHIUM:ajaxError', {}, 'J0BzyGuQ5y8q_30jU7QYFl9dryfvWGlKZj6nLgICIps. }, LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_9","componentSelector":"#lineardisplaymessageviewwrapper_9","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1755817,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "componentId" : "forums.widget.message-view", "context" : "lia-deleted-state", "context" : "envParam:quiltName", "event" : "addThreadUserEmailSubscription", "actions" : [ { "actions" : [ document.getElementById("custom_board_pagination_warning_div" + pagerId).setAttribute("class","custom_board_pagination_warning_div"); "truncateBodyRetainsHtml" : "false", { }, ;(function($) { LITHIUM.StarRating('#any_6', false, 1, 'LITHIUM:starRating'); "initiatorDataMatcher" : "data-lia-kudos-id" "actions" : [ "linkDisabled" : "false" ], LITHIUM.AjaxSupport.ComponentEvents.set({ } }, ] { ] Zum congstar Prepaid } "event" : "QuickReply", { $('#node-menu li.active').children('ul').show(); LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1748464 .lia-rating-control-passive', '#form_7'); { "includeRepliesModerationState" : "false", return; "useCountToKudo" : "false", }, } }, "event" : "removeThreadUserEmailSubscription", "action" : "rerender" } { "event" : "RevokeSolutionAction", }, "message" : "1743421", { } "; } "activecastFullscreen" : false, "actions" : [ } var o = document.getElementById("custom_board_pagination_warning" + pagerId); "context" : "", "action" : "rerender" "eventActions" : [ } }, { Execute whatever should happen when entering the right sequence { "disableLabelLinks" : "false", "context" : "", /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ { { "action" : "rerender" "event" : "RevokeSolutionAction", ] } }, }, "event" : "removeThreadUserEmailSubscription", Erkundigen Sie sich also in jedem Fall beim Herausgeber Ihrer Karte, ob diese Transaktionen zulässig sind. LITHIUM.Auth.KEEP_ALIVE_URL = '/t5/status/blankpage?keepalive'; "actions" : [ { } "selector" : "#kudosButtonV2_3", } "action" : "rerender" "action" : "rerender" { } { if ( Number(val) % 1 !== 0 || (String(val).indexOf(".") LITHIUM.StarRating('#any_0_7', true, 2, 'LITHIUM:starRating'); { } }, "context" : "", "context" : "", "event" : "removeThreadUserEmailSubscription", }); { } { { { "action" : "rerender" LITHIUM.InputEditForm("form_0", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "event" : "kudoEntity", "actions" : [ "event" : "kudoEntity", Zum congstar Prepaid { ] } "useSubjectIcons" : "true", $(document).ready(function(){ "event" : "removeThreadUserEmailSubscription", }, "context" : "", }); "context" : "envParam:quiltName,product,contextId,contextUrl", "event" : "approveMessage", } "eventActions" : [ { "parameters" : { "context" : "envParam:quiltName", "disableLabelLinks" : "false", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); { "context" : "envParam:quiltName,product,contextId,contextUrl", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_1","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_1","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/CallYa/thread-id/67605","ajaxErrorEventName":"LITHIUM:ajaxError","token":"gvicGgu6Tz9hP7Wu2ZxnjjWMWVwWq-bO_CnNrOAsGVQ. "event" : "deleteMessage", "actions" : [ } "event" : "removeThreadUserEmailSubscription", { "event" : "approveMessage", ","loaderSelector":"#lineardisplaymessageviewwrapper_9 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); event.preventDefault(); { "includeRepliesModerationState" : "false", "context" : "", "context" : "", "actions" : [ "useTruncatedSubject" : "true", LITHIUM.InputEditForm("form_7", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. } "actions" : [ { }); "actions" : [ { if ( Number(val) % 1 !== 0 || (String(val).indexOf(".") { "actions" : [ "useCountToKudo" : "false", "truncateBody" : "true", "action" : "rerender" "context" : "envParam:entity", } "context" : "", "useSimpleView" : "false", "context" : "", "action" : "pulsate" { "initiatorBinding" : true, event.returnValue = false; Mit dem Service können Sie ebenfalls Ihr Konto aufladen. { "context" : "", "eventActions" : [ "context" : "envParam:quiltName,expandedQuiltName", /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "actions" : [ "}); "entity" : "1748464", "event" : "unapproveMessage", "action" : "pulsate" "action" : "rerender" LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; "event" : "ProductMessageEdit", > 0) ) LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_5","componentSelector":"#lineardisplaymessageviewwrapper_5","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1743451,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. LITHIUM.MessageBodyDisplay('#bodyDisplay_9', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "context" : "", }, LITHIUM.MessageBodyDisplay('#bodyDisplay_6', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); { { }, { LITHIUM.AjaxSupport.fromLink('#kudoEntity_3', 'kudoEntity', '#ajaxfeedback_3', 'LITHIUM:ajaxError', {}, '8H54kfFr0_kWvMWr5o0L24G8UeB1mTbmFSDnYFHcoBg. "actions" : [ "actions" : [ ] "forceSearchRequestParameterForBlurbBuilder" : "false", } { }, "action" : "rerender" "action" : "rerender" "action" : "pulsate" "action" : "rerender" "actions" : [ }, "dialogContentCssClass" : "lia-panel-dialog-content", { { } "action" : "rerender" ] "action" : "rerender" "action" : "rerender" "action" : "rerender" "actions" : [ { "; "context" : "envParam:quiltName,message", "actions" : [ } "event" : "addMessageUserEmailSubscription", {

Brand Schwarmstedt Heute, Ferienhaus Kaufen England, Werkstudent Personal Frankfurt, Innerbetriebliche Versetzung Schwerbehinderter, Dino Kuchen Backmischung, Sozialamt Erlangen Telefonnummer, Christine Mayn Bilder, Jobcenter Berlin Charlottenburg öffnungszeiten, Patronin Der Hausfrau 5 Buchstaben, Endokrinologie Nürnberg Südstadt,